Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAI16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RAI16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157748
|
Novus Biologicals
NBP157748 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RAI16 Polyclonal specifically detects RAI16 in Human samples. It is validated for Western Blot.Specifications
| RAI16 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| family with sequence similarity 160, member B2, FLJ11125, FLJ21801, MGC138352, RAI16, retinoic acid induced 16, Retinoic acid-induced protein 16 | |
| Synthetic peptides corresponding to RAI16 (family with sequence similarity 160, member B2) The peptide sequence was selected from the N terminal of RAI16)(50ug). Peptide sequence HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q86V87 | |
| 64760 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title