Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RalA/RalB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17963320UL

 View more versions of this product

Catalog No. NBP17963320


Add to cart

Description

Description

RalA/RalB Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RalA/RalB
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
RALA
Synthetic peptide directed towards the middle region of human RALAThe immunogen for this antibody is RALA. Peptide sequence GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV.
23 kDa
20ul
Signal Transduction
Primary
5898
Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry
NP_005393
MGC48949, RAL, Ras family small GTP binding protein RALA, RAS-like protein A, ras-related protein Ral-A, v-ral simian leukemia viral oncogene homolog A (ras related)
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit