Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAPGEF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RAPGEF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157045
|
Novus Biologicals
NBP157045 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RAPGEF3 Polyclonal specifically detects RAPGEF3 in Human samples. It is validated for Western Blot.Specifications
| RAPGEF3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| O95398 | |
| 10411 | |
| Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the middle region of RAPGEF3. Peptide sequence HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 9330170P05Rik, bcm910, cAMP-GEFI, cAMP-regulated guanine nucleotide exchange factor I, CGEF1, EPAC 1, EPAC1, EPACRAP guanine-nucleotide-exchange factor (GEF) 3, Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, HSU79275, MGC21410, Rap guanine nucleotide exchange factor (GEF) 3, rap guanine nucleotide exchange factor 3, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP | |
| RAPGEF3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title