Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAPGEF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen RAPGEF3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157045
View Documents
Novus Biologicals
NBP157045
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

RAPGEF3 Polyclonal specifically detects RAPGEF3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RAPGEF3
Polyclonal
Rabbit
Signal Transduction
O95398
10411
Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the middle region of RAPGEF3. Peptide sequence HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
9330170P05Rik, bcm910, cAMP-GEFI, cAMP-regulated guanine nucleotide exchange factor I, CGEF1, EPAC 1, EPAC1, EPACRAP guanine-nucleotide-exchange factor (GEF) 3, Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, HSU79275, MGC21410, Rap guanine nucleotide exchange factor (GEF) 3, rap guanine nucleotide exchange factor 3, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP
RAPGEF3
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit