Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RARRES3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15939520UL
Description
RARRES3 Polyclonal specifically detects RARRES3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RARRES3 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q9UL19 | |
RARRES3 | |
Synthetic peptides corresponding to RARRES3(retinoic acid receptor responder (tazarotene induced) 3) The peptide sequence was selected from the middle region of RARRES3. Peptide sequence FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV. | |
20 μL | |
Tumor Suppressors, Vision | |
5920 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HRASLS4, PLA1/2-3, RAR-responsive protein TIG3, retinoic acid receptor responder (tazarotene induced) 3, retinoic acid receptor responder protein 3, retinoic acid-inducible gene 1, Retinoid-inducible gene 1 protein, RIG1, Tazarotene-induced gene 3 protein, TIG3MGC8906 | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title