RARRES3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15939520UL

Catalog No. NBP15939520

Description

RARRES3 Polyclonal specifically detects RARRES3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RARRES3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9UL19
• Gene Symbols: RARRES3
• Immunogen: Synthetic peptides corresponding to RARRES3(retinoic acid receptor responder (tazarotene induced) 3) The peptide sequence was selected from the middle region of RARRES3. Peptide sequence FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV.
• Quantity: 20 μL
• Research Discipline: Tumor Suppressors, Vision
• Gene ID (Entrez): 5920
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HRASLS4, PLA1/2-3, RAR-responsive protein TIG3, retinoic acid receptor responder (tazarotene induced) 3, retinoic acid receptor responder protein 3, retinoic acid-inducible gene 1, Retinoid-inducible gene 1 protein, RIG1, Tazarotene-induced gene 3 protein, TIG3MGC8906
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified