Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RARRES3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RARRES3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15939520
View Documents
Novus Biologicals
NBP15939520UL
20 μL
Each for $152.22
Add to cart
 
NBP159395
View Documents
Novus Biologicals
NBP159395
100 μL
Each for $436.00
Add to cart
 
Description

Description

RARRES3 Polyclonal specifically detects RARRES3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

RARRES3
Polyclonal
Purified
RUO
Human
Q9UL19
5920
Synthetic peptides corresponding to RARRES3(retinoic acid receptor responder (tazarotene induced) 3) The peptide sequence was selected from the middle region of RARRES3. Peptide sequence FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Tumor Suppressors, Vision
PBS and 2% Sucrose with 0.09% Sodium Azide
HRASLS4, PLA1/2-3, RAR-responsive protein TIG3, retinoic acid receptor responder (tazarotene induced) 3, retinoic acid receptor responder protein 3, retinoic acid-inducible gene 1, Retinoid-inducible gene 1 protein, RIG1, Tazarotene-induced gene 3 protein, TIG3MGC8906
RARRES3
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit