RASGEF1C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158874

Catalog No. NBP158874

Description

RASGEF1C Polyclonal specifically detects RASGEF1C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RASGEF1C
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N431
• Gene Symbols: RASGEF1C
• Immunogen: Synthetic peptides corresponding to RASGEF1C(RasGEF domain family, member 1C) The peptide sequence was selected from the middle region of RASGEF1C. Peptide sequence FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 255426
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ35841, RasGEF domain family, member 1C, ras-GEF domain-containing family member 1C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG