Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASGEF1C Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RASGEF1C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158874
|
Novus Biologicals
NBP158874 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RASGEF1C Polyclonal specifically detects RASGEF1C in Human samples. It is validated for Western Blot.Specifications
| RASGEF1C | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q8N431 | |
| 255426 | |
| Synthetic peptides corresponding to RASGEF1C(RasGEF domain family, member 1C) The peptide sequence was selected from the middle region of RASGEF1C. Peptide sequence FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ35841, RasGEF domain family, member 1C, ras-GEF domain-containing family member 1C | |
| RASGEF1C | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title