Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Rat Il13 (P42203) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6087

Catalog No. 89-948-646


Add to cart

Description

Description

Sequence: TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Specifications

Specifications

P42203
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
12.3kDa
E. coli expression system
10 ug
Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
<0.1ng/μg (<1 EU/μg)
Il13
Rat ;Rat
Yes
E. coli expression system
Lyophilized
116553
Il13 (Rat) Recombinant Protein
0.98
TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
RUO
Il13
The ED50 determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 5.0ng/ml, corresponding to a specific activity of > 2 x 105 units/mg.
Escherichia coli
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit