Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBED1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RBED1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179821
|
Novus Biologicals
NBP179821 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RBED1 Polyclonal specifically detects RBED1 in Human samples. It is validated for Western Blot.Specifications
| RBED1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| NP_115589 | |
| 84173 | |
| Synthetic peptide directed towards the C terminal of human ELMOD3. Peptide sequence FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C330008I15Rik, ELMO domain-containing protein 3, ELMO/CED-12 domain containing 3, FLJ21977, FLJ35601, liver-specific organic anion transporter 3TM12, LST3, MGC111036, organic anion transporter LST-3b, RBED1, RBM29, RNA binding motif and ELMO domain 1, RNA binding motif and ELMO/CED-12 domain 1, RNA binding motif protein 29, RNA-binding motif and ELMO domain-containing protein 1, RNA-binding motif protein 29, RNA-binding protein 29 | |
| ELMOD3 | |
| IgG | |
| Affinity Purified | |
| 44 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title