Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RBED1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen RBED1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


RBED1 Polyclonal specifically detects RBED1 in Human samples. It is validated for Western Blot.


Synthetic peptide directed towards the C terminal of human ELMOD3. Peptide sequence FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
C330008I15Rik, ELMO domain-containing protein 3, ELMO/CED-12 domain containing 3, FLJ21977, FLJ35601, liver-specific organic anion transporter 3TM12, LST3, MGC111036, organic anion transporter LST-3b, RBED1, RBM29, RNA binding motif and ELMO domain 1, RNA binding motif and ELMO/CED-12 domain 1, RNA binding motif protein 29, RNA-binding motif and ELMO domain-containing protein 1, RNA-binding motif protein 29, RNA-binding protein 29
Affinity Purified
44 kDa
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit