Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBJ Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | RBJ |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP158940
|
Novus Biologicals
NBP158940 |
100 μL |
Each of 1 for $436.00
|
|
Description
RBJ Polyclonal specifically detects RBJ in Human samples. It is validated for Western Blot.Specifications
RBJ | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
Q9NZQ0 | |
51277 | |
Synthetic peptides corresponding to RBJ(rab and DnaJ domain containing) The peptide sequence was selected from the middle region of RBJ. Peptide sequence CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp434N211, DnaJ (Hsp40) homolog, subfamily C, member 27, rab and DnaJ domain containing, Rab and DnaJ domain-containing protein, RABJS, Ras-associated protein Rap1, RBJdnaJ homolog subfamily C member 27 | |
DNAJC27 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title