RBM3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182411

Catalog No. NBP182411

Description

RBM3 Polyclonal specifically detects RBM3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: RBM3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_058089
• Gene Symbols: RBM3
• Immunogen: Synthetic peptide towards Rbm3. Peptide sequence LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNP.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 5935
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: IS1-RNPL, putative RNA-binding protein 3, RNA binding motif (RNP1, RRM) protein 3, RNA binding motif protein 3, RNA-binding motif protein 3, RNPL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG