Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM42 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RBM42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157523
|
Novus Biologicals
NBP157523 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RBM42 Polyclonal specifically detects RBM42 in Human samples. It is validated for Western Blot.Specifications
| RBM42 | |
| Polyclonal | |
| Rabbit | |
| MGC10433, RNA binding motif protein 42, RNA-binding motif protein 42, RNA-binding protein 42 | |
| RBM42 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 79171 | |
| Synthetic peptides corresponding to RBM42 (RNA binding motif protein 42) The peptide sequence was selected from the middle region of RBM42)(50ug). Peptide sequence RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title