Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RBMS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RBMS1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1582320
View Documents
Novus Biologicals
NBP15823120UL
20 μL
Each for $152.22
Add to cart
 
NBP158231
View Documents
Novus Biologicals
NBP158231
100 μL
Each for $436.00
Add to cart
 
Description

Description

RBMS1 Polyclonal specifically detects RBMS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

RBMS1
Polyclonal
Purified
RUO
P29558-2
5937
Synthetic peptides corresponding to RBMS1 (RNA binding motif, single stranded interacting protein 1) The peptide sequence was selected from the C terminal of RBMS1. Peptide sequence TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein 1, suppressor of cdc 2 (cdc13) with RNA binding motif 2
RBMS1
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit