Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBMS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RBMS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB5727120UL
|
Novus Biologicals
NBP15727120UL |
20 μL |
Each for $152.22
|
|
NBP157271
|
Novus Biologicals
NBP157271 |
100 μL |
Each for $436.00
|
|
Description
RBMS2 Polyclonal specifically detects RBMS2 in Human samples. It is validated for Western Blot.Specifications
| RBMS2 | |
| Polyclonal | |
| Rabbit | |
| Q15434 | |
| 5939 | |
| Synthetic peptides corresponding to RBMS2(RNA binding motif, single stranded interacting protein 2) The peptide sequence was selected from the N terminal of RBMS2. Peptide sequence MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ39093, FLJ40023, RNA binding motif, single stranded interacting protein 2, RNA-binding motif, single-stranded-interacting protein 2, SCR3FLJ43262, Suppressor of CDC2 with RNA-binding motif 3 | |
| RBMS2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title