Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBPMS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RBPMS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15739920
|
Novus Biologicals
NBP15739920UL |
20 μL |
Each for $152.22
|
|
NBP157399
|
Novus Biologicals
NBP157399 |
100 μL |
Each for $436.00
|
|
Description
RBPMS2 Polyclonal specifically detects RBPMS2 in Human samples. It is validated for Western Blot.Specifications
| RBPMS2 | |
| Polyclonal | |
| Rabbit | |
| Q6ZRY4 | |
| 348093 | |
| Synthetic peptides corresponding to RBPMS2(RNA binding protein with multiple splicing 2) The peptide sequence was selected from the middle region of RBPMS2. Peptide sequence MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| RNA binding protein with multiple splicing 2, RNA-binding protein with multiple splicing 2 | |
| RBPMS2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title