Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RCAN2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen RCAN2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


RCAN2 Polyclonal specifically detects RCAN2 in Human samples. It is validated for Western Blot.


Signal Transduction
Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2), calcipressin-2, Down syndrome candidate region 1-like 1, Down syndrome critical region gene 1-like 1, DSCR1L1MCIP2ZAKI4RCN2, hRCN2, Myocyte-enriched calcineurin-interacting protein 2, regulator of calcineurin 2CSP2, thyroid hormone-responsive (skin fibroblasts), Thyroid hormone-responsive protein ZAKI-4, ZAKI-4
Affinity Purified
22 kDa
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit