Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RCAN2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen RCAN2
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123511
View Documents
Novus Biologicals
NBP309305100UL
100 μg
Each for $352.89
Add to cart
 
NB123512
View Documents
Novus Biologicals
NBP30930525UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

RCAN2 Polyclonal antibody specifically detects RCAN2 in Human samples. It is validated for Western Blot
Specifications

Specifications

RCAN2
Western Blot
Purified
RUO
Human
Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2), calcipressin-2, Down syndrome candidate region 1-like 1, Down syndrome critical region gene 1-like 1, DSCR1L1MCIP2ZAKI4RCN2, hRCN2, Myocyte-enriched calcineurin-interacting protein 2, regulator of calcineurin 2CSP2, thyroid hormone-responsive (skin fibroblasts), Thyroid hormone-responsive protein ZAKI-4, ZAKI-4
The immunogen is a synthetic peptide directed towards the middle region of HUMAN RCAN2. Peptide sequence VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Signal Transduction
PBS buffer, 2% sucrose
10231
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit