Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RCAN3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen RCAN3
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125055
View Documents
Novus Biologicals
NBP310077100UL
100 μg
Each for $352.89
Add to cart
 
NB125056
View Documents
Novus Biologicals
NBP31007725UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

RCAN3 Polyclonal antibody specifically detects RCAN3 in Human samples. It is validated for Western Blot
Specifications

Specifications

RCAN3
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
11123
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
Down syndrome candidate region 1-like 2, Down syndrome critical region gene 1-like 2, DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5, hRCN3, Myocyte-enriched calcineurin-interacting protein 3, RCAN family member 3, RCN3, Regulator of calcineurin 3, regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2, regulator of calcineurin 3 isoform 1b2,34,5, regulator of calcineurin 3 isoform 1c2,34,5, regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
The immunogen is a synthetic peptide directed towards the middle region of human RCAN3 (NP_001238906.1). Peptide sequence QKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDAM
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit