Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155461
Description
RD3 Polyclonal specifically detects RD3 in Human samples. It is validated for Western Blot.Specifications
RD3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q7Z3Z2 | |
RD3 | |
Synthetic peptides corresponding to RD3(retinal degeneration 3) The peptide sequence was selected from the N terminal of RD3. Peptide sequence GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV. | |
Affinity Purified | |
RUO | |
343035 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LCA12C1orf36chromosome 1 open reading frame 36, protein RD3, retinal degeneration 3 | |
Rabbit | |
23 kDa | |
100 μL | |
Primary | |
Canine 79%. | |
Human, Canine | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title