Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RDH11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157976
Description
RDH11 Polyclonal specifically detects RDH11 in Human samples. It is validated for Western Blot.Specifications
RDH11 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Androgen-regulated short-chain dehydrogenase/reductase 1, ARSDR1CGI82, EC 1.1.1.300, HCBP12, HCV core-binding protein HCBP12, MDT1, prostate short-chain dehydrogenase reductase 1, Prostate short-chain dehydrogenase/reductase 1, PSDR1FLJ32633, RALR1, Retinal reductase 1, retinol dehydrogenase 11, retinol dehydrogenase 11 (all-trans and 9-cis), retinol dehydrogenase 11 (all-trans/9-cis/11-cis), SCALD, SDR7C1, short chain dehydrogenase/reductase family 7C, member 1 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Rat: 100%; Mouse: 91%; Guinea pig: 85%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8TC12 | |
RDH11 | |
Synthetic peptides corresponding to RDH11(retinol dehydrogenase 11 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the C terminal of RDH11. Peptide sequence SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR. | |
100 μL | |
Vision | |
51109 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction