Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RDH12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158017
Description
RDH12 Polyclonal specifically detects RDH12 in Human samples. It is validated for Western Blot.Specifications
RDH12 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
All-trans and 9-cis retinol dehydrogenase, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ30273, LCA13retinol dehydrogenase 12, all-trans and 9-cis, LCA3, retinol dehydrogenase 12, retinol dehydrogenase 12 (all-trans and 9-cis), retinol dehydrogenase 12 (all-trans/9-cis/11-cis), SDR7C2, short chain dehydrogenase/reductase family 7C, member 2 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Zebrafish: 92%; Bovine: 84%; Chicken: 84%; Pig: 84%; Rabbit: 84%; Guinea pig: 76%. | |
Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96NR8 | |
RDH12 | |
Synthetic peptides corresponding to RDH12(retinol dehydrogenase 12 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the middle region of RDH12. Peptide sequence AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT. | |
100 μL | |
Vision | |
145226 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction