Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RDH12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RDH12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15801720
View Documents
Novus Biologicals
NBP15801720UL
20 μL
Each for $152.22
Add to cart
 
NBP158017
View Documents
Novus Biologicals
NBP158017
100 μL
Each for $436.00
Add to cart
 
Description

Description

RDH12 Polyclonal specifically detects RDH12 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RDH12
Polyclonal
Rabbit
Vision
Q96NR8
145226
Synthetic peptides corresponding to RDH12(retinol dehydrogenase 12 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the middle region of RDH12. Peptide sequence AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
All-trans and 9-cis retinol dehydrogenase, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ30273, LCA13retinol dehydrogenase 12, all-trans and 9-cis, LCA3, retinol dehydrogenase 12, retinol dehydrogenase 12 (all-trans and 9-cis), retinol dehydrogenase 12 (all-trans/9-cis/11-cis), SDR7C2, short chain dehydrogenase/reductase family 7C, member 2
RDH12
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit