RDM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153147

Catalog No. NBP153147

Description

RDM1 Polyclonal specifically detects RDM1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RDM1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC33977, RAD52 homolog B, RAD52 homolog B (S. cerevisiae), RAD52 motif 1, RAD52 motif-containing protein 1, RAD52B
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A8MY68
• Gene Symbols: RDM1
• Immunogen: Synthetic peptides corresponding to RDM1(RAD52 motif 1) The peptide sequence was selected from the middle region of RDM1. Peptide sequence NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 201299
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG