Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen RDM1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP153147
View Documents
Novus Biologicals
NBP153147
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

RDM1 Polyclonal specifically detects RDM1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RDM1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
MGC33977, RAD52 homolog B, RAD52 homolog B (S. cerevisiae), RAD52 motif 1, RAD52 motif-containing protein 1, RAD52B
RDM1
IgG
Affinity Purified
26 kDa
Western Blot
Unconjugated
RUO
A8MY68
201299
Synthetic peptides corresponding to RDM1(RAD52 motif 1) The peptide sequence was selected from the middle region of RDM1. Peptide sequence NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit