Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RECK Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | RECK |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125459
|
Novus Biologicals
NBP310279100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
RECK Polyclonal specifically detects RECK in Mouse samples. It is validated for Western Blot.Specifications
| RECK | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS buffer, 2% sucrose | |
| 8434 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs), suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs), Suppressor of tumorigenicity 15 protein | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse RECK (NP_057887.2). Peptide sequence MNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEY | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title