Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RECK Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen RECK
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125459
View Documents
Novus Biologicals
NBP310279100UL
100 μg
Each for $352.89
Add to cart
 
NB125460
View Documents
Novus Biologicals
NBP31027925UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

RECK Polyclonal antibody specifically detects RECK in Mouse samples. It is validated for Western Blot
Specifications

Specifications

RECK
Western Blot
Purified
RUO
Mouse
hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs), suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs), Suppressor of tumorigenicity 15 protein
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RECK (NP_057887.2). Peptide sequence MNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEY
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cell Cycle and Replication
PBS buffer, 2% sucrose
8434
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit