RERG Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168972

Catalog No. NBP168972

Description

RERG Polyclonal specifically detects RERG in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RERG
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96A58
• Gene Symbols: RERG
• Immunogen: Synthetic peptides corresponding to RERG (RAS-like, estrogen-regulated, growth inhibitor) The peptide sequence was selected from the C terminal of RERG. Peptide sequence CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC15754, RAS-like, estrogen-regulated, growth inhibitor, ras-related and estrogen-regulated growth inhibitor
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 85004
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
• Isotype: IgG