Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RERG Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | RERG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168972
|
Novus Biologicals
NBP168972 |
100 μL |
Each of 1 for $436.00
|
|
Description
RERG Polyclonal specifically detects RERG in Human samples. It is validated for Western Blot.Specifications
RERG | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
Q96A58 | |
85004 | |
Synthetic peptides corresponding to RERG (RAS-like, estrogen-regulated, growth inhibitor) The peptide sequence was selected from the C terminal of RERG. Peptide sequence CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC15754, RAS-like, estrogen-regulated, growth inhibitor, ras-related and estrogen-regulated growth inhibitor | |
RERG | |
IgG | |
Affinity Purified | |
22 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title