Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
REV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309940100UL
Description
REV1 Polyclonal specifically detects REV1 in Human samples. It is validated for Western Blot.Specifications
REV1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AIBP80, Alpha integrin-binding protein 80, DNA repair protein REV1, EC 2.7.7.-, FLJ21523, MGC163283, MGC26225, REV1 (yeast homolog)- like, REV1 homolog (S. cerevisiae), REV1- like, REV1L, REV1-like (yeast), Rev1-like terminal deoxycytidyl transferase | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1 (XP_005264024). Peptide sequence INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51455 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction