Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

REV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen REV1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124782
View Documents
Novus Biologicals
NBP30994025UL
25 μg
Each for $106.19
Add to cart
 
NB124781
View Documents
Novus Biologicals
NBP309940100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

REV1 Polyclonal antibody specifically detects REV1 in Human samples. It is validated for Western Blot
Specifications

Specifications

REV1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
51455
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
AIBP80, Alpha integrin-binding protein 80, DNA repair protein REV1, EC 2.7.7.-, FLJ21523, MGC163283, MGC26225, REV1 (yeast homolog)- like, REV1 homolog (S. cerevisiae), REV1- like, REV1L, REV1-like (yeast), Rev1-like terminal deoxycytidyl transferase
The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1 (XP_005264024). Peptide sequence INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit