Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RFPL4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15503220UL

 View more versions of this product

Catalog No. NBP15503220

Add to cart



RFPL4B Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS & 2% Sucrose. with No Preservative
Affinity Purified
Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA.
30 kDa
Zinc Finger
Western Blot
Western Blot 1:100-1:2000
ret finger protein-like 4B, RNF211RING finger protein 211
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit