Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RFPL4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155031

 View more versions of this product

Catalog No. NBP155031


Add to cart

Description

Description

RFPL4B Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RFPL4B
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
RFPL4B
Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence MTKQHNSRLEQSLHVREELRHFREDVTLDAATASSLLVFSNDLRSAQCKK.
30 kDa
100 ul
Zinc Finger
Primary
442247
Human
Western Blot
Western Blot 1:100-1:2000
Q6ZWI9
ret finger protein-like 4B, RNF211RING finger protein 211
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit