Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RG9MTD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15736120UL
Description
RG9MTD1 Polyclonal specifically detects RG9MTD1 in Human samples. It is validated for Western Blot.Specifications
RG9MTD1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q7L0Y3 | |
TRMT10C | |
Synthetic peptides corresponding to RG9MTD1 (RNA (guanine-9-) methyltransferase domain containing 1) The peptide sequence was selected from the middle region of RG9MTD1. Peptide sequence MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 2.1.1, EC 2.1.1.-, EC 2.1.1.36, FLJ20432, HBV pre-S2 trans-regulated protein 2, Mitochondrial RNase P protein 1, MRPP1mitochondrial ribonuclease P protein 1, NY-REN-49 antigen, Renal carcinoma antigen NY-REN-49, RNA (guanine-9-) methyltransferase domain containing 1, RNA (guanine-9-)-methyltransferase domain-containing protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
54931 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction