Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RG9MTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RG9MTD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1573620
|
Novus Biologicals
NBP15736120UL |
20 μL |
Each for $152.22
|
|
NBP157361
|
Novus Biologicals
NBP157361 |
100 μL |
Each for $436.00
|
|
Description
RG9MTD1 Polyclonal specifically detects RG9MTD1 in Human samples. It is validated for Western Blot.Specifications
RG9MTD1 | |
Polyclonal | |
Rabbit | |
Q7L0Y3 | |
54931 | |
Synthetic peptides corresponding to RG9MTD1 (RNA (guanine-9-) methyltransferase domain containing 1) The peptide sequence was selected from the middle region of RG9MTD1. Peptide sequence MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.1.1, EC 2.1.1.-, EC 2.1.1.36, FLJ20432, HBV pre-S2 trans-regulated protein 2, Mitochondrial RNase P protein 1, MRPP1mitochondrial ribonuclease P protein 1, NY-REN-49 antigen, Renal carcinoma antigen NY-REN-49, RNA (guanine-9-) methyltransferase domain containing 1, RNA (guanine-9-)-methyltransferase domain-containing protein 1 | |
TRMT10C | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title