Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RG9MTD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180478
Description
RG9MTD2 Polyclonal specifically detects RG9MTD2 in Human samples. It is validated for Western Blot.Specifications
| RG9MTD2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| NP_689505 | |
| TRMT10A | |
| Synthetic peptide directed towards the middle region of human RG9MTD2. Peptide sequence EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Rat: 85%; Mouse: 78%. | |
| Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC27034, RNA (guanine-9-) methyltransferase domain containing 2 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 93587 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title