Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RG9MTD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RG9MTD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18047820
|
Novus Biologicals
NBP18047820UL |
20 μL |
Each for $152.22
|
|
NBP180478
|
Novus Biologicals
NBP180478 |
100 μL |
Each for $436.00
|
|
Description
RG9MTD2 Polyclonal specifically detects RG9MTD2 in Human samples. It is validated for Western Blot.Specifications
| RG9MTD2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_689505 | |
| 93587 | |
| Synthetic peptide directed towards the middle region of human RG9MTD2. Peptide sequence EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC27034, RNA (guanine-9-) methyltransferase domain containing 2 | |
| TRMT10A | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title