Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RGS20 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15488520UL

 View more versions of this product

Catalog No. NBP15488520

Add to cart



RGS20 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptide directed towards the middle region of human RGS20 (NP_003693). Peptide sequence NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS.
25 kDa
Signal Transduction
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 2.5 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
G(z)GAP, Gz-GAP, Gz-selective GTPase-activating protein, regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, regulator of G-protein signalling 20, Regulator of Gz-selective protein signaling 1, RGSZ1g(z)GAP, ZGAP1gz-GAP
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit