Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RGS20 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$116.82 - $343.85

Specifications

Antigen RGS20
Immunogen Synthetic peptide directed towards the middle region of human RGS20 (NP_003693). Peptide sequence NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15488520
View Documents
Novus Biologicals
NBP15488520UL
20ul Each for $116.82
Add to cart
 
NBP154885
View Documents
Novus Biologicals
NBP154885
100ul Each for $343.85
Add to cart
 
Description

Description

RGS20 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

RGS20
Rabbit
Polyclonal
Unconjugated
8601
Purified
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
RUO
Synthetic peptide directed towards the middle region of human RGS20 (NP_003693). Peptide sequence NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS.
Primary
IgG
G(z)GAP, Gz-GAP, Gz-selective GTPase-activating protein, regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, regulator of G-protein signalling 20, Regulator of Gz-selective protein signaling 1, RGSZ1g(z)GAP, ZGAP1gz-GAP
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit