Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RGS8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180510
|
Novus Biologicals
NBP180510 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RGS8 Polyclonal specifically detects RGS8 in Human samples. It is validated for Western Blot.Specifications
| RGS8 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC119067, MGC119068, MGC119069, regulator of G-protein signaling 8, regulator of G-protein signalling 8 | |
| RGS8 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| NP_203131 | |
| 85397 | |
| Synthetic peptide directed towards the N terminal of human RGS8. Peptide sequence NKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title