Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RhoF Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RhoF
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1551620
View Documents
Novus Biologicals
NBP15511620UL
20 μL
Each for $152.22
Add to cart
 
NBP155116
View Documents
Novus Biologicals
NBP155116
100 μL
Each for $436.00
Add to cart
 
Description

Description

RhoF Polyclonal specifically detects RhoF in Human samples. It is validated for Western Blot.
Specifications

Specifications

RhoF
Polyclonal
Rabbit
Signal Transduction
Q9HBH0
54509
Synthetic peptides corresponding to RHOF(ras homolog gene family, member F (in filopodia)) The peptide sequence was selected from the middle region of RHOF. Peptide sequence DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ20247, ras homolog gene family, member F (in filopodia), Rho family GTPase Rif, Rho in filopodia, rho-related GTP-binding protein RhoF, RIFARHF
RHOF
IgG
Affinity Purified
23 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit