Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RhoF Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RhoF |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1551620
|
Novus Biologicals
NBP15511620UL |
20 μL |
Each for $152.22
|
|
NBP155116
|
Novus Biologicals
NBP155116 |
100 μL |
Each for $436.00
|
|
Description
RhoF Polyclonal specifically detects RhoF in Human samples. It is validated for Western Blot.Specifications
RhoF | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
Q9HBH0 | |
54509 | |
Synthetic peptides corresponding to RHOF(ras homolog gene family, member F (in filopodia)) The peptide sequence was selected from the middle region of RHOF. Peptide sequence DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ20247, ras homolog gene family, member F (in filopodia), Rho family GTPase Rif, Rho in filopodia, rho-related GTP-binding protein RhoF, RIFARHF | |
RHOF | |
IgG | |
Affinity Purified | |
23 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title