Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RhoG Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17979420UL
Description
RhoG Polyclonal specifically detects RhoG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RhoG | |
Polyclonal | |
Western Blot 1:1000, Immunohistochemistry | |
NP_001656 | |
RHOG | |
Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), RhoG, rho-related GTP-binding protein RhoG | |
Rabbit | |
21 kDa | |
20 μL | |
Cell Cycle and Replication | |
391 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title