Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RHOXF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310524100UL
Description
RHOXF1 Polyclonal specifically detects RHOXF1 in Human samples. It is validated for Western Blot.Specifications
RHOXF1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
MGC119030, OTEXMGC119033, Ovary-, testis- and epididymis-expressed gene protein, Paired-like homeobox protein PEPP-1, PEPP subfamily gene 1, PEPP1paired-like homeobox protein OTEX, rhox homeobox family member 1, Rhox homeobox family, member 1 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human RHOXF1 (NP_644811). Peptide sequence ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM | |
100 μg | |
Signal Transduction | |
158800 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction