Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RHOXF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310457100UL
Description
RHOXF2 Polyclonal specifically detects RHOXF2 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
RHOXF2 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
CT107, Paired-like homeobox protein PEPP-2, PEPP subfamily gene 2, PEPP-2, PEPP2cancer/testis antigen 107, rhox homeobox family member 2, Rhox homeobox family, member 2, Testis homeobox gene 1, THG1homeobox protein from AL590526 | |
The immunogen is a synthetic peptide directed towards the middle region of human RHOXF2 (NP_115887). Peptide sequence DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQ | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
84528 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction