Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RHPN1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155003

 View more versions of this product

Catalog No. NBP155003


Add to Cart

Description

Description

RHPN1 Polyclonal specifically detects RHPN1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RHPN1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
GTP-Rho-binding protein 1, KIAA1929outer dense fiber of sperm tails 5, ODF5, RHOPHILIN, rhophilin 1, rhophilin, Rho GTPase binding protein 1, rhophilin-1, RHPN
Rabbit
73 kDa
100 μL
Signal Transduction
114822
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q8TCX5-2
RHPN1
Synthetic peptides corresponding to RHPN1(rhophilin, Rho GTPase binding protein 1) The peptide sequence was selected from the middle region of RHPN1. Peptide sequence SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP.
Affinity purified
RUO
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit