Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RHPN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15500320UL

 View more versions of this product

Catalog No. NBP15500320


Add to cart

Description

Description

RHPN1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RHPN1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
RHPN1
Synthetic peptides corresponding to RHPN1(rhophilin, Rho GTPase binding protein 1) The peptide sequence was selected from the middle region of RHPN1. Peptide sequence SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP.
73 kDa
20ul
Signal Transduction
Primary
114822
Western Blot
Western Blot 1:100-1:2000
Q8TCX5-2
GTP-Rho-binding protein 1, KIAA1929outer dense fiber of sperm tails 5, ODF5, RHOPHILIN, rhophilin 1, rhophilin, Rho GTPase binding protein 1, rhophilin-1, RHPN
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit