RHPN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155003

Catalog No. NBP155003

Description

RHPN1 Polyclonal specifically detects RHPN1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RHPN1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TCX5-2
• Gene Symbols: RHPN1
• Immunogen: Synthetic peptides corresponding to RHPN1(rhophilin, Rho GTPase binding protein 1) The peptide sequence was selected from the middle region of RHPN1. Peptide sequence SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GTP-Rho-binding protein 1, KIAA1929outer dense fiber of sperm tails 5, ODF5, RHOPHILIN, rhophilin 1, rhophilin, Rho GTPase binding protein 1, rhophilin-1, RHPN
• Host Species: Rabbit
• Molecular Weight of Antigen: 73 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 114822
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG