Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RIAM/APBB1IP Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191631

 View more versions of this product

Catalog No. NBP191631


Add to cart

Description

Description

RIAM/APBB1IP Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

RIAM/APBB1IP
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
APBB1IP
Synthetic peptide directed towards the N terminal of human Apbb1ip (NP_001094047). Peptide sequence PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK.
74 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Zebrafish: 86%.
Rat
Western Blot
Western Blot 0.2-1 ug/ml
D3ZDZ1
amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
54518
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit