Ribosomal Protein L17 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174075

Catalog No. NBP174075

Description

Ribosomal Protein L17 Polyclonal specifically detects Ribosomal Protein L17 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Ribosomal Protein L17
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9CPR4
• Gene Symbols: RPL17
• Immunogen: Synthetic peptides corresponding to the N terminal of Rpl17. Immunizing peptide sequence SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6139
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ18762,60S ribosomal protein L23, FLJ92089, gene encoding putative NFkB activating protein, MGC117162, PD-1, ribosomal protein L17, rpL23, RPL23,60S ribosomal protein L17
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Goat: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Xenopus: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
• Isotype: IgG