Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ribosomal Protein L17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Ribosomal Protein L17 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174075
|
Novus Biologicals
NBP174075 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
Ribosomal Protein L17 Polyclonal specifically detects Ribosomal Protein L17 in Mouse samples. It is validated for Western Blot.Specifications
| Ribosomal Protein L17 | |
| Polyclonal | |
| Rabbit | |
| Q9CPR4 | |
| 6139 | |
| Synthetic peptides corresponding to the N terminal of Rpl17. Immunizing peptide sequence SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ18762,60S ribosomal protein L23, FLJ92089, gene encoding putative NFkB activating protein, MGC117162, PD-1, ribosomal protein L17, rpL23, RPL23,60S ribosomal protein L17 | |
| RPL17 | |
| IgG | |
| 20 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title