Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RLBP1L1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | RLBP1L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155138
|
Novus Biologicals
NBP155138 |
100 μL |
Each of 1 for $436.00
|
|
Description
RLBP1L1 Polyclonal specifically detects RLBP1L1 in Human samples. It is validated for Western Blot.Specifications
RLBP1L1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Cellular retinaldehyde-binding protein-like, clavesin 1, clavesin-1, CRALBPLC6orf212L, FLJ37248, MGC34646, retinaldehyde binding protein 1-like 1, Retinaldehyde-binding protein 1-like 1, RLBP1L1 | |
CLVS1 | |
IgG | |
Affinity Purified | |
41 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8IUQ0 | |
157807 | |
Synthetic peptides corresponding to RLBP1L1(retinaldehyde binding protein 1-like 1) The peptide sequence was selected from the middle region of RLBP1L1. Peptide sequence MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title